HORDB

General Information

ID: hor006525
Uniprot ID: P01283
Protein name: Intestinal peptide PHV-42
Gene name: Vip
Organism: Rattus norvegicus (Rat)
Family: Glucagon family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0051428 peptide hormone receptor binding
GO BP: GO:0001938 positive regulation of endothelial cell proliferation; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway; GO:0007611 learning or memory; GO:0009966 regulation of signal transduction; GO:0032812 positive regulation of epinephrine secretion; GO:0032879 regulation of localization; GO:0032880 regulation of protein localization; GO:0043066 negative regulation of apoptotic process; GO:0043267 negative regulation of potassium ion transport; GO:0045732 positive regulation of protein catabolic process; GO:0048242 epinephrine secretion; GO:0048255 mRNA stabilization; GO:0048662 negative regulation of smooth muscle cell proliferation; GO:0060406 positive regulation of penile erection; GO:0070459 prolactin secretion
GO CC: GO:0005576 extracellular region; GO:0043005 neuron projection; GO:0043025 neuronal cell body

Sequence Information

Sequence: HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV
Length: 42
Propeptide: MESRSKPQFLAILTLFSVLFSQSLAWPLYGPPSSVRLDDRLQFEGAGDPDQVSLKADSDILQNALAENDTPYYDVSRNARHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGDSPDFLEELEK
Signal peptide: MESRSKPQFLAILTLFSVLFS
Modification: T27 Isoleucine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin (By similarity). PHI also causes vasodilation.
Mechanism: NA
Cross BBB: NA
Target: Vipr2
Target Unid: P35000
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure

Disulfide bond: NA
Structure ID: AF-P01283-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006525_AF2.pdb

hor006525_ESM.pdb

Physical Information

Mass:	529664	Formula:	C203H328N54O65
Absent amino acids:	CMNW	Common amino acids:	S
pI:	7.53	Basic residues:	6
Polar residues:	14	Hydrophobic residues:	14
Hydrophobicity:	-16.19	Boman Index:	-6562
Half-Life:	3.5 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	99.76
Instability Index:	5475.24	Extinction Coefficient cystines:	2980
Absorbance 280nm:	72.68

Literature

PubMed ID: 2159586
Title: The complete structure of the rat VIP gene.
PubMed ID: 3838518
Title: Nucleotide sequence divergence and functional constraint in VIP precursor mRNA evolution between human and rat.
PubMed ID: 1851524
Title: Characterization of the gene and messages for vasoactive intestinal polypeptide (VIP) in rat and mouse.
PubMed ID: 3379062
Title: Structurally distinctive vasoactive intestinal peptides from rat basophilic leukemia cells.
PubMed ID: 8402943
Title: Variants of vasoactive intestinal peptide in mouse mast cells and rat basophilic leukemia cells.
PubMed ID: 22673903
Title: Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.